SCOPe 2.08: Domain d1wuwa_: 1wuw A:

Lineage for d1wuwa_ (1wuw A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.13: Crambin-like [57428] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.13.1: Crambin-like [57429] (1 family)
   automatically mapped to Pfam PF00321

5. Family g.13.1.1: Crambin-like [57430] (10 proteins)

6. Protein Hordothionin [118247] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [118248] (1 PDB entry)
   Uniprot P21742 28-72

8. Domain d1wuwa_: 1wuw A: [114908]
   complexed with ser, tsu

Details for d1wuwa_

PDB Entry: 1wuw, 1.9 Å

PDB Description: crystal structure of beta hordothionin

PDB Compounds: (A:) Beta-hordothionin

SCOPe Domain Sequences for d1wuwa_:

Sequence; same for both SEQRES and ATOM records:

>d1wuwa_ g.13.1.1 (A:) Hordothionin {Barley (Hordeum vulgare) [TaxId: 4513]}
ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk

Timeline for d1wuwa_:

• d1wuwa_ first appeared in SCOP 1.71
  
• d1wuwa_ appears in SCOPe 2.07