Lineage for d1wuud2 (1wuu D:217-392)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029631Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1029682Family d.58.26.7: Galactokinase [103011] (1 protein)
  6. 1029683Protein Galactokinase [103012] (3 species)
  7. 1029684Species Human (Homo sapiens) [TaxId:9606] [117981] (1 PDB entry)
    Uniprot P51570
  8. 1029688Domain d1wuud2: 1wuu D:217-392 [114907]
    Other proteins in same PDB: d1wuua1, d1wuub1, d1wuuc1, d1wuud1
    complexed with anp, gla, mg

Details for d1wuud2

PDB Entry: 1wuu (more details), 2.5 Å

PDB Description: crystal structure of human galactokinase complexed with mgamppnp and galactose
PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d1wuud2:

Sequence, based on SEQRES records: (download)

>d1wuud2 d.58.26.7 (D:217-392) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhslasseypvrrrqceevaralgkeslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

Sequence, based on observed residues (ATOM records): (download)

>d1wuud2 d.58.26.7 (D:217-392) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhssseypvrrrqceevaralgkeslrevqleeleaardlvskegfrra
rhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgv
ygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

SCOPe Domain Coordinates for d1wuud2:

Click to download the PDB-style file with coordinates for d1wuud2.
(The format of our PDB-style files is described here.)

Timeline for d1wuud2: