Lineage for d1wuud2 (1wuu D:217-392)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954566Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954628Family d.58.26.7: Galactokinase [103011] (2 proteins)
  6. 2954629Protein Galactokinase [103012] (3 species)
  7. 2954630Species Human (Homo sapiens) [TaxId:9606] [117981] (1 PDB entry)
    Uniprot P51570
  8. 2954634Domain d1wuud2: 1wuu D:217-392 [114907]
    Other proteins in same PDB: d1wuua1, d1wuua3, d1wuub1, d1wuuc1, d1wuuc3, d1wuud1, d1wuud3
    complexed with anp, gla, mg

Details for d1wuud2

PDB Entry: 1wuu (more details), 2.5 Å

PDB Description: crystal structure of human galactokinase complexed with mgamppnp and galactose
PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d1wuud2:

Sequence, based on SEQRES records: (download)

>d1wuud2 d.58.26.7 (D:217-392) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhslasseypvrrrqceevaralgkeslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

Sequence, based on observed residues (ATOM records): (download)

>d1wuud2 d.58.26.7 (D:217-392) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhssseypvrrrqceevaralgkeslrevqleeleaardlvskegfrra
rhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgv
ygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

SCOPe Domain Coordinates for d1wuud2:

Click to download the PDB-style file with coordinates for d1wuud2.
(The format of our PDB-style files is described here.)

Timeline for d1wuud2: