SCOP 1.71: Domain d1wuud1: 1wuu D:2-216

Lineage for d1wuud1 (1wuu D:2-216)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)

6. Protein Galactokinase [102762] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117793] (1 PDB entry)

8. Domain d1wuud1: 1wuu D:2-216 [114906]
   Other proteins in same PDB: d1wuua2, d1wuub2, d1wuuc2, d1wuud2
   complexed with anp, gal, mg

Details for d1wuud1

PDB Entry: 1wuu, 2.5 Å

PDB Description: crystal structure of human galactokinase complexed with mgamppnp and galactose

SCOP Domain Sequences for d1wuud1:

Sequence; same for both SEQRES and ATOM records:

>d1wuud1 d.14.1.5 (D:2-216) Galactokinase {Human (Homo sapiens)}
aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt
vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap
lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp
cgimdqfislmgqkghallidcrsletslvplsdp

Timeline for d1wuud1:

• d1wuud1 is new in SCOP 1.71
  
• d1wuud1 appears in SCOP 1.73
  
• d1wuud1 appears in the current release, SCOPe 2.08