Lineage for d1wuuc1 (1wuu C:2-216)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716877Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)
  6. 716884Protein Galactokinase [102762] (3 species)
  7. 716895Species Human (Homo sapiens) [TaxId:9606] [117793] (1 PDB entry)
  8. 716898Domain d1wuuc1: 1wuu C:2-216 [114904]
    Other proteins in same PDB: d1wuua2, d1wuub2, d1wuuc2, d1wuud2

Details for d1wuuc1

PDB Entry: 1wuu (more details), 2.5 Å

PDB Description: crystal structure of human galactokinase complexed with mgamppnp and galactose
PDB Compounds: (C:) Galactokinase

SCOP Domain Sequences for d1wuuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuuc1 d.14.1.5 (C:2-216) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt
vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap
lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp
cgimdqfislmgqkghallidcrsletslvplsdp

SCOP Domain Coordinates for d1wuuc1:

Click to download the PDB-style file with coordinates for d1wuuc1.
(The format of our PDB-style files is described here.)

Timeline for d1wuuc1: