![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
![]() | Protein Galactokinase [102762] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117793] (1 PDB entry) Uniprot P51570 |
![]() | Domain d1wuuc1: 1wuu C:2-216 [114904] Other proteins in same PDB: d1wuua2, d1wuua3, d1wuub2, d1wuuc2, d1wuuc3, d1wuud2, d1wuud3 complexed with anp, gla, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wuu (more details), 2.5 Å
SCOPe Domain Sequences for d1wuuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuuc1 d.14.1.5 (C:2-216) Galactokinase {Human (Homo sapiens) [TaxId: 9606]} aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp cgimdqfislmgqkghallidcrsletslvplsdp
Timeline for d1wuuc1: