Lineage for d1wuua2 (1wuu A:217-392)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863524Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 863575Family d.58.26.7: Galactokinase [103011] (1 protein)
  6. 863576Protein Galactokinase [103012] (3 species)
  7. 863587Species Human (Homo sapiens) [TaxId:9606] [117981] (1 PDB entry)
    Uniprot P51570
  8. 863588Domain d1wuua2: 1wuu A:217-392 [114901]
    Other proteins in same PDB: d1wuua1, d1wuub1, d1wuuc1, d1wuud1

Details for d1wuua2

PDB Entry: 1wuu (more details), 2.5 Å

PDB Description: crystal structure of human galactokinase complexed with mgamppnp and galactose
PDB Compounds: (A:) Galactokinase

SCOP Domain Sequences for d1wuua2:

Sequence, based on SEQRES records: (download)

>d1wuua2 d.58.26.7 (A:217-392) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhslasseypvrrrqceevaralgkeslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

Sequence, based on observed residues (ATOM records): (download)

>d1wuua2 d.58.26.7 (A:217-392) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhasseypvrrrqceevaralgkeslrevqleeleaardlvskegfrra
rhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgv
ygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

SCOP Domain Coordinates for d1wuua2:

Click to download the PDB-style file with coordinates for d1wuua2.
(The format of our PDB-style files is described here.)

Timeline for d1wuua2: