SCOP 1.75: Domain d1wufb2: 1wuf B:2001-2126

Lineage for d1wufb2 (1wuf B:2001-2126)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Listeria innocua [TaxId:1642] [117926] (1 PDB entry)
   Uniprot Q927X3; Lin2664; protein assignment by sequence similarity

8. Domain d1wufb2: 1wuf B:2001-2126 [114899]
   Other proteins in same PDB: d1wufa1, d1wufb1
   Structural genomics target
   complexed with mg

Details for d1wufb2

PDB Entry: 1wuf, 2.9 Å

PDB Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262

PDB Compounds: (B:) hypothetical protein lin2664

SCOP Domain Sequences for d1wufb2:

Sequence; same for both SEQRES and ATOM records:

>d1wufb2 d.54.1.1 (B:2001-2126) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]}
myfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdyteet
lssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrsl
akmiga

Timeline for d1wufb2:

• d1wufb2 first appeared in SCOP 1.71
  
• d1wufb2 appears in SCOP 1.73
  
• d1wufb2 appears in SCOPe 2.01
  
• d1wufb2 appears in the current release, SCOPe 2.08