Lineage for d1wufb2 (1wuf B:2001-2126)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602981Protein N-acylamino acid racemase [110937] (4 species)
  7. 603015Species Listeria innocua [TaxId:1642] [117926] (1 PDB entry)
  8. 603017Domain d1wufb2: 1wuf B:2001-2126 [114899]
    Other proteins in same PDB: d1wufa1, d1wufb1
    Structural genomics target
    complexed with mg

Details for d1wufb2

PDB Entry: 1wuf (more details), 2.9 Å

PDB Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262

SCOP Domain Sequences for d1wufb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wufb2 d.54.1.1 (B:2001-2126) N-acylamino acid racemase {Listeria innocua}
myfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdyteet
lssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrsl
akmiga

SCOP Domain Coordinates for d1wufb2:

Click to download the PDB-style file with coordinates for d1wufb2.
(The format of our PDB-style files is described here.)

Timeline for d1wufb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wufb1