Lineage for d1wufb1 (1wuf B:2127-2370)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 573010Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins)
  6. 573099Protein N-acylamino acid racemase [110372] (4 species)
  7. 573133Species Listeria innocua [TaxId:1642] [117383] (1 PDB entry)
  8. 573135Domain d1wufb1: 1wuf B:2127-2370 [114898]
    Other proteins in same PDB: d1wufa2, d1wufb2
    Structural genomics target
    complexed with mg

Details for d1wufb1

PDB Entry: 1wuf (more details), 2.9 Å

PDB Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262

SCOP Domain Sequences for d1wufb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wufb1 c.1.11.2 (B:2127-2370) N-acylamino acid racemase {Listeria innocua}
tkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrksfpklsl
madansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricldenirsvk
dveqahsigscrainlklarvggmssalkiaeycalneilvwcggmleagvgrahniala
arnefvfpgdisasnrffaedivtpafelnqgrlkvptnegigvtldlkvlkkytkstee
illn

SCOP Domain Coordinates for d1wufb1:

Click to download the PDB-style file with coordinates for d1wufb1.
(The format of our PDB-style files is described here.)

Timeline for d1wufb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wufb2