Lineage for d1wufa2 (1wuf A:1001-1126)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602981Protein N-acylamino acid racemase [110937] (4 species)
  7. 603015Species Listeria innocua [TaxId:1642] [117926] (1 PDB entry)
  8. 603016Domain d1wufa2: 1wuf A:1001-1126 [114897]
    Other proteins in same PDB: d1wufa1, d1wufb1

Details for d1wufa2

PDB Entry: 1wuf (more details), 2.9 Å

PDB Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262

SCOP Domain Sequences for d1wufa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wufa2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Listeria innocua}
myfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdyteet
lssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrsl
akmiga

SCOP Domain Coordinates for d1wufa2:

Click to download the PDB-style file with coordinates for d1wufa2.
(The format of our PDB-style files is described here.)

Timeline for d1wufa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wufa1