SCOP 1.73: Domain d1wufa1: 1wuf A:1127-1370

Lineage for d1wufa1 (1wuf A:1127-1370)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)

6. Protein N-acylamino acid racemase [110372] (4 species)

7. Species Listeria innocua [TaxId:1642] [117383] (1 PDB entry)

8. Domain d1wufa1: 1wuf A:1127-1370 [114896]
   Other proteins in same PDB: d1wufa2, d1wufb2

Details for d1wufa1

PDB Entry: 1wuf, 2.9 Å

PDB Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262

PDB Compounds: (A:) hypothetical protein lin2664

SCOP Domain Sequences for d1wufa1:

Sequence; same for both SEQRES and ATOM records:

>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]}
tkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrksfpklsl
madansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricldenirsvk
dveqahsigscrainlklarvggmssalkiaeycalneilvwcggmleagvgrahniala
arnefvfpgdisasnrffaedivtpafelnqgrlkvptnegigvtldlkvlkkytkstee
illn

Timeline for d1wufa1:

• d1wufa1 first appeared in SCOP 1.71
  
• d1wufa1 appears in SCOP 1.75
  
• d1wufa1 appears in the current release, SCOPe 2.08