SCOP 1.71: Domain d1wueb2: 1wue B:2001-2126

Lineage for d1wueb2 (1wue B:2001-2126)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Enterococcus faecalis [TaxId:1351] [117925] (1 PDB entry)

8. Domain d1wueb2: 1wue B:2001-2126 [114895]
   Other proteins in same PDB: d1wuea1, d1wueb1
   Structural genomics target

Details for d1wueb2

PDB Entry: 1wue, 2.1 Å

PDB Description: crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583

SCOP Domain Sequences for d1wueb2:

Sequence; same for both SEQRES and ATOM records:

>d1wueb2 d.54.1.1 (B:2001-2126) N-acylamino acid racemase {Enterococcus faecalis}
mniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyvqet
lvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqksl
teffgp

Timeline for d1wueb2:

• d1wueb2 is new in SCOP 1.71
  
• d1wueb2 appears in SCOP 1.73
  
• d1wueb2 appears in the current release, SCOPe 2.08