Lineage for d1wueb1 (1wue B:2127-2367)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817947Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 818012Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 818133Protein N-acylamino acid racemase [110372] (4 species)
  7. 818165Species Enterococcus faecalis [TaxId:1351] [117382] (1 PDB entry)
    Uniprot Q838J7; EF0450; protein assignment by sequence similarity
  8. 818167Domain d1wueb1: 1wue B:2127-2367 [114894]
    Other proteins in same PDB: d1wuea2, d1wueb2
    Structural genomics target

Details for d1wueb1

PDB Entry: 1wue (more details), 2.1 Å

PDB Description: crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583
PDB Compounds: (B:) mandelate racemase/muconate lactonizing enzyme family protein

SCOP Domain Sequences for d1wueb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wueb1 c.1.11.2 (B:2127-2367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]}
trrkipvgislgiqedlpqllkqvqlavekgyqrvklkirpgydvepvalirqhfpnlpl
mvdansaytladlpqlqrldhyqlamieqpfaaddfldhaqlqrelktricldenirslk
dcqvalalgscrsinlkiprvggihealkiaafcqendllvwlggmfesgvgralnlqfa
sqptfsfpgdisateryfyediitepfileqgtmtvpqglgigvtlsqtnllkysqyqki
m

SCOP Domain Coordinates for d1wueb1:

Click to download the PDB-style file with coordinates for d1wueb1.
(The format of our PDB-style files is described here.)

Timeline for d1wueb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wueb2