![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins) |
![]() | Protein N-acylamino acid racemase [110372] (4 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [117382] (1 PDB entry) |
![]() | Domain d1wuea1: 1wue A:1127-1367 [114892] Other proteins in same PDB: d1wuea2, d1wueb2 |
PDB Entry: 1wue (more details), 2.1 Å
SCOP Domain Sequences for d1wuea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis} trrkipvgislgiqedlpqllkqvqlavekgyqrvklkirpgydvepvalirqhfpnlpl mvdansaytladlpqlqrldhyqlamieqpfaaddfldhaqlqrelktricldenirslk dcqvalalgscrsinlkiprvggihealkiaafcqendllvwlggmfesgvgralnlqfa sqptfsfpgdisateryfyediitepfileqgtmtvpqglgigvtlsqtnllkysqyqki m
Timeline for d1wuea1: