Lineage for d1wuba_ (1wub A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806605Superfamily b.61.6: YceI-like [101874] (2 families) (S)
  5. 2806606Family b.61.6.1: YceI-like [101875] (2 proteins)
    Pfam PF04264
  6. 2806613Protein Polyisoprenoid-binding protein TTHA0802 (TT1927B) [101876] (1 species)
  7. 2806614Species Thermus thermophilus [TaxId:274] [101877] (2 PDB entries)
    Uniprot P83815
    structural genomics
  8. 2806615Domain d1wuba_: 1wub A: [114891]
    Structural genomics target
    complexed with otp

Details for d1wuba_

PDB Entry: 1wub (more details), 1.65 Å

PDB Description: Crystal structure of the polyisoprenoid-binding protein, TT1927b, from Thermus thermophilus HB8
PDB Compounds: (A:) conserved hypothetical protein TT1927b

SCOPe Domain Sequences for d1wuba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuba_ b.61.6.1 (A:) Polyisoprenoid-binding protein TTHA0802 (TT1927B) {Thermus thermophilus [TaxId: 274]}
mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgep
qrdghlrsadflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapi
kdpwgmqrvaasasgqinrkdwnltwnqvlelgallvgeevkfnleveavapapva

SCOPe Domain Coordinates for d1wuba_:

Click to download the PDB-style file with coordinates for d1wuba_.
(The format of our PDB-style files is described here.)

Timeline for d1wuba_: