![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.6: YceI-like [101874] (2 families) ![]() |
![]() | Family b.61.6.1: YceI-like [101875] (2 proteins) Pfam PF04264 |
![]() | Protein Polyisoprenoid-binding protein TTHA0802 (TT1927B) [101876] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [101877] (2 PDB entries) Uniprot P83815 structural genomics |
![]() | Domain d1wuba_: 1wub A: [114891] Structural genomics target complexed with otp |
PDB Entry: 1wub (more details), 1.65 Å
SCOPe Domain Sequences for d1wuba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuba_ b.61.6.1 (A:) Polyisoprenoid-binding protein TTHA0802 (TT1927B) {Thermus thermophilus [TaxId: 274]} mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgep qrdghlrsadflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapi kdpwgmqrvaasasgqinrkdwnltwnqvlelgallvgeevkfnleveavapapva
Timeline for d1wuba_: