SCOPe 2.06: Domain d1wu3i_: 1wu3 I:

Lineage for d1wu3i_ (1wu3 I:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-beta [47309] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47311] (4 PDB entries)
   Uniprot P01575 22-182
   CA-atoms only

8. Domain d1wu3i_: 1wu3 I: [114890]

Details for d1wu3i_

PDB Entry: 1wu3, 2.15 Å

PDB Description: crystal structure of recombinant murine interferon beta

PDB Compounds: (I:) Interferon beta

SCOPe Domain Sequences for d1wu3i_:

Sequence; same for both SEQRES and ATOM records:

>d1wu3i_ a.26.1.3 (I:) Interferon-beta {Mouse (Mus musculus) [TaxId: 10090]}
inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq
nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy
ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfqn

Timeline for d1wu3i_:

• d1wu3i_ first appeared in SCOP 1.71
  
• d1wu3i_ appears in SCOPe 2.05
  
• d1wu3i_ appears in SCOPe 2.07
  
• d1wu3i_ appears in the current release, SCOPe 2.08