SCOP 1.75: Domain d1wu2b3: 1wu2 B:181-324

Lineage for d1wu2b3 (1wu2 B:181-324)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)

6. Protein MoeA, central domain [64104] (4 species)

7. Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117666] (1 PDB entry)
   Uniprot O59354

8. Domain d1wu2b3: 1wu2 B:181-324 [114889]
   Other proteins in same PDB: d1wu2a1, d1wu2a2, d1wu2b1, d1wu2b2
   Structural genomics target; PH1647

Details for d1wu2b3

PDB Entry: 1wu2, 2.3 Å

PDB Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3

PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1wu2b3:

Sequence, based on SEQRES records:

>d1wu2b3 c.57.1.2 (B:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
ketlekaknecdivlitggsafgdkdyahkfvnllfhgttikpgrpfgygekvfimsgyp
vsvfaqfnlfvkhalakmvgaqny

Sequence, based on observed residues (ATOM records):

>d1wu2b3 c.57.1.2 (B:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
ketlekaknecdivlitgfvnllfhgttikpgrpfgygekvfimsgypvsvfaqfnlfvk
halakmvgaqny

Timeline for d1wu2b3:

• d1wu2b3 first appeared in SCOP 1.71
  
• d1wu2b3 appears in SCOP 1.73
  
• d1wu2b3 appears in SCOPe 2.01
  
• d1wu2b3 appears in the current release, SCOPe 2.08