Class b: All beta proteins [48724] (174 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) |
Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117342] (1 PDB entry) Uniprot O59354 |
Domain d1wu2b2: 1wu2 B:6-180 [114888] Other proteins in same PDB: d1wu2a1, d1wu2a3, d1wu2b1, d1wu2b3 Structural genomics target; PH1647 |
PDB Entry: 1wu2 (more details), 2.3 Å
SCOPe Domain Sequences for d1wu2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wu2b2 b.103.1.1 (B:6-180) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} klvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyaira edtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkre gdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvk
Timeline for d1wu2b2: