SCOPe 2.01: Domain d1wu2b2: 1wu2 B:6-180

Lineage for d1wu2b2 (1wu2 B:6-180)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)

7. Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117342] (1 PDB entry)
   Uniprot O59354

8. Domain d1wu2b2: 1wu2 B:6-180 [114888]
   Other proteins in same PDB: d1wu2a1, d1wu2a3, d1wu2b1, d1wu2b3
   Structural genomics target; PH1647

Details for d1wu2b2

PDB Entry: 1wu2, 2.3 Å

PDB Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3

PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1wu2b2:

Sequence; same for both SEQRES and ATOM records:

>d1wu2b2 b.103.1.1 (B:6-180) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
klvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyaira
edtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkre
gdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvk

Timeline for d1wu2b2:

• d1wu2b2 first appeared in SCOP 1.71
  
• d1wu2b2 appears in SCOP 1.75
  
• d1wu2b2 appears in SCOPe 2.02
  
• d1wu2b2 appears in the current release, SCOPe 2.08