![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) |
![]() | Protein MoeA, central domain [64104] (4 species) |
![]() | Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117666] (1 PDB entry) Uniprot O59354 |
![]() | Domain d1wu2a3: 1wu2 A:181-324 [114886] Other proteins in same PDB: d1wu2a1, d1wu2a2, d1wu2b1, d1wu2b2 Structural genomics target; PH1647 |
PDB Entry: 1wu2 (more details), 2.3 Å
SCOPe Domain Sequences for d1wu2a3:
Sequence, based on SEQRES records: (download)
>d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii ketlekaknecdivlitggsafgdkdyahkfvnllfhgttikpgrpfgygekvfimsgyp vsvfaqfnlfvkhalakmvgaqny
>d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii ketlekaknecdivlitdyahkfvnllfhgttikpgrpfgygekvfimsgypvsvfaqfn lfvkhalakmvgaqny
Timeline for d1wu2a3: