SCOPe 2.07: Domain d1wtya_: 1wty A:

Lineage for d1wtya_ (1wty A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families)

5. Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins)
   automatically mapped to Pfam PF08780

6. Protein Probable nucleotidyltransferase subunit TTHA0048 [116876] (1 species)

7. Species Thermus thermophilus [TaxId:274] [116877] (3 PDB entries)
   Uniprot Q5SM95
   Structural genomics target

8. Domain d1wtya_: 1wty A: [114880]
   Structural genomics target

Details for d1wtya_

PDB Entry: 1wty, 2.2 Å

PDB Description: Crystal structure of a probable nucleotidyl transferase protein from thermus thermophilus HB8

PDB Compounds: (A:) hypothetical protein TTHA0048

SCOPe Domain Sequences for d1wtya_:

Sequence; same for both SEQRES and ATOM records:

>d1wtya_ a.24.16.2 (A:) Probable nucleotidyltransferase subunit TTHA0048 {Thermus thermophilus [TaxId: 274]}
aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrlee

Timeline for d1wtya_:

• d1wtya_ first appeared in SCOP 1.71
  
• d1wtya_ appears in SCOPe 2.06
  
• d1wtya_ appears in the current release, SCOPe 2.08