Lineage for d1wtya_ (1wty A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535832Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (4 families) (S)
  5. 535840Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins)
  6. 535847Protein Probable nucleotidyltransferase subunit TTHA0048 [116876] (1 species)
  7. 535848Species Thermus thermophilus [TaxId:274] [116877] (1 PDB entry)
    Structural genomics target
  8. 535849Domain d1wtya_: 1wty A: [114880]

Details for d1wtya_

PDB Entry: 1wty (more details), 2.2 Å

PDB Description: Crystal structure of a probable nucleotidyl transferase protein from thermus thermophilus HB8

SCOP Domain Sequences for d1wtya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtya_ a.24.16.2 (A:) Probable nucleotidyltransferase subunit TTHA0048 {Thermus thermophilus}
aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrlee

SCOP Domain Coordinates for d1wtya_:

Click to download the PDB-style file with coordinates for d1wtya_.
(The format of our PDB-style files is described here.)

Timeline for d1wtya_: