Lineage for d1wtdb_ (1wtd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121538Family c.52.1.29: Restriction endonuclease EcoO109IR [117635] (1 protein)
  6. 2121539Protein Restriction endonuclease EcoO109IR [117636] (1 species)
  7. 2121540Species Escherichia coli [TaxId:562] [117637] (2 PDB entries)
    Uniprot Q9RPJ3
  8. 2121544Domain d1wtdb_: 1wtd B: [114875]
    complexed with gol

Details for d1wtdb_

PDB Entry: 1wtd (more details), 2.4 Å

PDB Description: Crystal structure of type II restrcition endonuclease, EcoO109I DNA-free form
PDB Compounds: (B:) EcoO109IR

SCOPe Domain Sequences for d1wtdb_:

Sequence, based on SEQRES records: (download)

>d1wtdb_ c.52.1.29 (B:) Restriction endonuclease EcoO109IR {Escherichia coli [TaxId: 562]}
mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi
ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie
kfkehvakkyneqvlnadgtaqwhkllemine

Sequence, based on observed residues (ATOM records): (download)

>d1wtdb_ c.52.1.29 (B:) Restriction endonuclease EcoO109IR {Escherichia coli [TaxId: 562]}
mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilgan
hnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdliekfkeh
vakkyneqvlnadgtaqwhkllemine

SCOPe Domain Coordinates for d1wtdb_:

Click to download the PDB-style file with coordinates for d1wtdb_.
(The format of our PDB-style files is described here.)

Timeline for d1wtdb_: