Lineage for d1wsxa1 (1wsx A:152-308)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250926Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2250927Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2251038Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)
  7. 2251041Species Mouse (Mus musculus) [TaxId:10090] [118213] (5 PDB entries)
    Uniprot P97287 152-308
  8. 2251046Domain d1wsxa1: 1wsx A:152-308 [114867]
    Other proteins in same PDB: d1wsxa2

Details for d1wsxa1

PDB Entry: 1wsx (more details)

PDB Description: solution structure of mcl-1
PDB Compounds: (A:) myeloid cell leukemia sequence 1

SCOPe Domain Sequences for d1wsxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsxa1 f.1.4.1 (A:152-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
eddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqg
mlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqesfiepl
aetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

SCOPe Domain Coordinates for d1wsxa1:

Click to download the PDB-style file with coordinates for d1wsxa1.
(The format of our PDB-style files is described here.)

Timeline for d1wsxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wsxa2