Lineage for d1wswa_ (1wsw A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 825905Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
    binds FMN
  6. 825906Protein Flavodoxin [52220] (9 species)
  7. 825941Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 825946Domain d1wswa_: 1wsw A: [114866]
    complexed with fmn; mutant

Details for d1wswa_

PDB Entry: 1wsw (more details), 1.69 Å

PDB Description: low temperature (100k) crystal structure of flavodoxin mutant s64c, dimer, semiquinone state
PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1wswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wswa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1wswa_:

Click to download the PDB-style file with coordinates for d1wswa_.
(The format of our PDB-style files is described here.)

Timeline for d1wswa_: