SCOPe 2.08: Domain d1wswa_: 1wsw A:

Lineage for d1wswa_ (1wsw A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (11 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
   Uniprot P00323

8. Domain d1wswa_: 1wsw A: [114866]
   complexed with fmn; mutant

Details for d1wswa_

PDB Entry: 1wsw, 1.69 Å

PDB Description: low temperature (100k) crystal structure of flavodoxin mutant s64c, dimer, semiquinone state

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1wswa_:

Sequence; same for both SEQRES and ATOM records:

>d1wswa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1wswa_:

• d1wswa_ first appeared in SCOP 1.71
  
• d1wswa_ appears in SCOPe 2.07