Lineage for d1wsje_ (1wsj E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2886016Protein RNase H (RNase HI) [53100] (4 species)
  7. 2886017Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
    Uniprot P0A7Y4
  8. 2886039Domain d1wsje_: 1wsj E: [114861]
    mutant

Details for d1wsje_

PDB Entry: 1wsj (more details), 2 Å

PDB Description: crystal structure of e.coli rnase hi active site mutant (k87a/h124a)
PDB Compounds: (E:) ribonuclease hi

SCOPe Domain Sequences for d1wsje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsje_ c.55.3.1 (E:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vkgaaghpenercdelaraaamnptledtgyqv

SCOPe Domain Coordinates for d1wsje_:

Click to download the PDB-style file with coordinates for d1wsje_.
(The format of our PDB-style files is described here.)

Timeline for d1wsje_: