Lineage for d1wsib_ (1wsi B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586647Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 586755Protein RNase H (RNase HI) [53100] (3 species)
  7. 586761Species Escherichia coli [TaxId:562] [53101] (27 PDB entries)
  8. 586785Domain d1wsib_: 1wsi B: [114854]

Details for d1wsib_

PDB Entry: 1wsi (more details), 2 Å

PDB Description: crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n)

SCOP Domain Sequences for d1wsib_:

Sequence, based on SEQRES records: (download)

>d1wsib_ c.55.3.1 (B:) RNase H (RNase HI) {Escherichia coli}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
kghaghpenercnelaraaamnptledtgyqv

Sequence, based on observed residues (ATOM records): (download)

>d1wsib_ c.55.3.1 (B:) RNase H (RNase HI) {Escherichia coli}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
kghpenercnelaraaamnptledtgyqv

SCOP Domain Coordinates for d1wsib_:

Click to download the PDB-style file with coordinates for d1wsib_.
(The format of our PDB-style files is described here.)

Timeline for d1wsib_: