SCOP 1.71: Domain d1wshd_: 1wsh D:

Lineage for d1wshd_ (1wsh D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Escherichia coli [TaxId:562] [53101] (27 PDB entries)

8. Domain d1wshd_: 1wsh D: [114852]
   mutant

Details for d1wshd_

PDB Entry: 1wsh, 1.9 Å

PDB Description: crystal structure of e.coli rnase hi active site mutant (e48a/k87a)

SCOP Domain Sequences for d1wshd_:

Sequence, based on SEQRES records:

>d1wshd_ c.55.3.1 (D:) RNase H (RNase HI) {Escherichia coli}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
kghaghpenercdelaraaamnptledtgyqvev

Sequence, based on observed residues (ATOM records):

>d1wshd_ c.55.3.1 (D:) RNase H (RNase HI) {Escherichia coli}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
hpenercdelaraaamnptledtgyqvev

Timeline for d1wshd_:

• d1wshd_ is new in SCOP 1.71
  
• d1wshd_ appears in SCOP 1.73
  
• d1wshd_ appears in the current release, SCOPe 2.08