SCOP 1.71: Domain d1wshc_: 1wsh C:

Lineage for d1wshc_ (1wsh C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Escherichia coli [TaxId:562] [53101] (27 PDB entries)

8. Domain d1wshc_: 1wsh C: [114851]

Details for d1wshc_

PDB Entry: 1wsh, 1.9 Å

PDB Description: crystal structure of e.coli rnase hi active site mutant (e48a/k87a)

SCOP Domain Sequences for d1wshc_:

Sequence, based on SEQRES records:

>d1wshc_ c.55.3.1 (C:) RNase H (RNase HI) {Escherichia coli}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
kghaghpenercdelaraaamnptledtgyq

Sequence, based on observed residues (ATOM records):

>d1wshc_ c.55.3.1 (C:) RNase H (RNase HI) {Escherichia coli}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
ghpenercdelaraaamnptledtgyq

Timeline for d1wshc_:

• d1wshc_ is new in SCOP 1.71
  
• d1wshc_ appears in SCOP 1.73
  
• d1wshc_ appears in the current release, SCOPe 2.08