SCOPe 2.08: Domain d1wsha_: 1wsh A:

Lineage for d1wsha_ (1wsh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein RNase H (RNase HI) [53100] (4 species)

7. Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
   Uniprot P0A7Y4

8. Domain d1wsha_: 1wsh A: [114849]
   mutant

Details for d1wsha_

PDB Entry: 1wsh, 1.9 Å

PDB Description: crystal structure of e.coli rnase hi active site mutant (e48a/k87a)

PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d1wsha_:

Sequence, based on SEQRES records:

>d1wsha_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
kghaghpenercdelaraaamnptledtgyqve

Sequence, based on observed residues (ATOM records):

>d1wsha_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
hpenercdelaraaamnptledtgyqve

Timeline for d1wsha_:

• d1wsha_ first appeared in SCOP 1.71
  
• d1wsha_ appears in SCOPe 2.07