Lineage for d1wsda_ (1wsd A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990724Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 990725Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 990726Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 990757Protein M-proteinase [52754] (1 species)
  7. 990758Species Bacillus sp., strain ksm-k16 [TaxId:1409] [52755] (2 PDB entries)
    Uniprot Q99405 112-380
  8. 990759Domain d1wsda_: 1wsd A: [114848]
    complexed with ca, so4

Details for d1wsda_

PDB Entry: 1wsd (more details), 1.5 Å

PDB Description: alkaline m-protease form i crystal structure
PDB Compounds: (A:) m-protease

SCOPe Domain Sequences for d1wsda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsda_ c.41.1.1 (A:) M-proteinase {Bacillus sp., strain ksm-k16 [TaxId: 1409]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagvaalvkqknpswsnvqi
rnhlkntatglgntnlygsglvnaeaatr

SCOPe Domain Coordinates for d1wsda_:

Click to download the PDB-style file with coordinates for d1wsda_.
(The format of our PDB-style files is described here.)

Timeline for d1wsda_: