Lineage for d1wsda_ (1wsd A:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.41: Subtilisin-like [52742] (1 superfamily)
3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3Superfamily c.41.1: Subtilisin-like [52743] (2 families) 
Family c.41.1.1: Subtilases [52744] (13 proteins) 
Protein M-proteinase [52754] (1 species) Species Bacillus sp., strain ksm-k16 [TaxId:1409] [52755] (2 PDB entries) 
Domain d1wsda_: 1wsd A: [114848]
complexed with ca, so4
Details for d1wsda_
PDB Entry: 1wsd (more details), 1.5 Å
PDB Description: alkaline m-protease form i crystal structure
SCOP Domain Sequences for d1wsda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wsda_ c.41.1.1 (A:) M-proteinase {Bacillus sp., strain ksm-k16}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagvaalvkqknpswsnvqi
rnhlkntatglgntnlygsglvnaeaatr
SCOP Domain Coordinates for d1wsda_:
Click to download the PDB-style file with coordinates for d1wsda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wsda_:
- d1wsda_ is new in SCOP 1.71
- d1wsda_ appears in SCOP 1.73
- d1wsda_ appears in the current release, SCOPe 2.08
View in 3D