SCOP 1.71: Domain d1wsba_: 1wsb A:

Lineage for d1wsba_ (1wsb A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (4 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (7 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)

8. Domain d1wsba_: 1wsb A: [114847]
   complexed with fmn; mutant

Details for d1wsba_

PDB Entry: 1wsb, 1.8 Å

PDB Description: flavodoxin mutant- s64c

SCOP Domain Sequences for d1wsba_:

Sequence; same for both SEQRES and ATOM records:

>d1wsba_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1wsba_:

• d1wsba_ is new in SCOP 1.71
  
• d1wsba_ appears in SCOP 1.73
  
• d1wsba_ appears in the current release, SCOPe 2.08