Lineage for d1wsba_ (1wsb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439109Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. 2439110Protein Flavodoxin [52220] (10 species)
  7. 2439146Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 2439154Domain d1wsba_: 1wsb A: [114847]
    complexed with fmn; mutant

Details for d1wsba_

PDB Entry: 1wsb (more details), 1.8 Å

PDB Description: Flavodoxin mutant- S64C
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1wsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsba_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOPe Domain Coordinates for d1wsba_:

Click to download the PDB-style file with coordinates for d1wsba_.
(The format of our PDB-style files is described here.)

Timeline for d1wsba_: