![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (11 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries) Uniprot P00323 |
![]() | Domain d1wsba_: 1wsb A: [114847] complexed with fmn; mutant |
PDB Entry: 1wsb (more details), 1.8 Å
SCOPe Domain Sequences for d1wsba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wsba_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq dglridgdpraarddivgwahdvrgai
Timeline for d1wsba_: