Lineage for d1ws8d_ (1ws8 D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553583Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 553786Protein Mavicyanin [117080] (1 species)
    Plantacyanin and stellacyanin homologue
  7. 553787Species Zucchini (Cucurbita pepo) [TaxId:3663] [117081] (2 PDB entries)
  8. 553791Domain d1ws8d_: 1ws8 D: [114846]
    complexed with cu, gol

Details for d1ws8d_

PDB Entry: 1ws8 (more details), 1.6 Å

PDB Description: Crystal Structure of Mavicyanin from Cucurbita pepo medullosa (Zucchini)

SCOP Domain Sequences for d1ws8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws8d_ b.6.1.1 (D:) Mavicyanin {Zucchini (Cucurbita pepo)}
matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd

SCOP Domain Coordinates for d1ws8d_:

Click to download the PDB-style file with coordinates for d1ws8d_.
(The format of our PDB-style files is described here.)

Timeline for d1ws8d_: