Lineage for d1ws8c_ (1ws8 C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660720Protein Mavicyanin [117080] (1 species)
    Plantacyanin and stellacyanin homologue
  7. 660721Species Zucchini (Cucurbita pepo) [TaxId:3663] [117081] (2 PDB entries)
  8. 660724Domain d1ws8c_: 1ws8 C: [114845]

Details for d1ws8c_

PDB Entry: 1ws8 (more details), 1.6 Å

PDB Description: Crystal Structure of Mavicyanin from Cucurbita pepo medullosa (Zucchini)
PDB Compounds: (C:) Mavicyanin

SCOP Domain Sequences for d1ws8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws8c_ b.6.1.1 (C:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]}
matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd

SCOP Domain Coordinates for d1ws8c_:

Click to download the PDB-style file with coordinates for d1ws8c_.
(The format of our PDB-style files is described here.)

Timeline for d1ws8c_: