SCOP 1.73: Domain d1ws8b_: 1ws8 B:

Lineage for d1ws8b_ (1ws8 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Mavicyanin [117080] (1 species)
   Plantacyanin and stellacyanin homologue

7. Species Zucchini (Cucurbita pepo) [TaxId:3663] [117081] (2 PDB entries)

8. Domain d1ws8b_: 1ws8 B: [114844]

Details for d1ws8b_

PDB Entry: 1ws8, 1.6 Å

PDB Description: Crystal Structure of Mavicyanin from Cucurbita pepo medullosa (Zucchini)

PDB Compounds: (B:) Mavicyanin

SCOP Domain Sequences for d1ws8b_:

Sequence; same for both SEQRES and ATOM records:

>d1ws8b_ b.6.1.1 (B:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]}
matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd

Timeline for d1ws8b_:

• d1ws8b_ first appeared in SCOP 1.71
  
• d1ws8b_ appears in SCOP 1.75
  
• d1ws8b_ appears in the current release, SCOPe 2.08