Lineage for d1ws8a_ (1ws8 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774493Protein Mavicyanin [117080] (1 species)
    Plantacyanin and stellacyanin homologue
  7. 1774494Species Zucchini (Cucurbita pepo) [TaxId:3663] [117081] (2 PDB entries)
    Uniprot P80728
  8. 1774495Domain d1ws8a_: 1ws8 A: [114843]
    complexed with cu, gol

Details for d1ws8a_

PDB Entry: 1ws8 (more details), 1.6 Å

PDB Description: Crystal Structure of Mavicyanin from Cucurbita pepo medullosa (Zucchini)
PDB Compounds: (A:) Mavicyanin

SCOPe Domain Sequences for d1ws8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]}
matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdp

SCOPe Domain Coordinates for d1ws8a_:

Click to download the PDB-style file with coordinates for d1ws8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ws8a_: