![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins) mono-domain proteins |
![]() | Protein Mavicyanin [117080] (1 species) Plantacyanin and stellacyanin homologue |
![]() | Species Zucchini (Cucurbita pepo) [TaxId:3663] [117081] (2 PDB entries) |
![]() | Domain d1ws8a_: 1ws8 A: [114843] |
PDB Entry: 1ws8 (more details), 1.6 Å
SCOP Domain Sequences for d1ws8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdp
Timeline for d1ws8a_: