SCOPe 2.05: Domain d1ws7c_: 1ws7 C:

Lineage for d1ws7c_ (1ws7 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Mavicyanin [117080] (1 species)
   Plantacyanin and stellacyanin homologue

7. Species Zucchini (Cucurbita pepo) [TaxId:3663] [117081] (2 PDB entries)
   Uniprot P80728

8. Domain d1ws7c_: 1ws7 C: [114841]
   complexed with cu1

Details for d1ws7c_

PDB Entry: 1ws7, 1.9 Å

PDB Description: crystal structure of mavicyanin from cucurbita pepo medullosa (zucchini)

PDB Compounds: (C:) Mavicyanin

SCOPe Domain Sequences for d1ws7c_:

Sequence; same for both SEQRES and ATOM records:

>d1ws7c_ b.6.1.1 (C:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]}
matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd

Timeline for d1ws7c_:

• d1ws7c_ first appeared in SCOP 1.71
  
• d1ws7c_ appears in SCOPe 2.04
  
• d1ws7c_ appears in SCOPe 2.06
  
• d1ws7c_ appears in the current release, SCOPe 2.08