Lineage for d1ws7a_ (1ws7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770811Protein Mavicyanin [117080] (1 species)
    Plantacyanin and stellacyanin homologue
  7. 2770812Species Zucchini (Cucurbita pepo) [TaxId:3663] [117081] (2 PDB entries)
    Uniprot P80728
  8. 2770817Domain d1ws7a_: 1ws7 A: [114839]
    complexed with cu1

Details for d1ws7a_

PDB Entry: 1ws7 (more details), 1.9 Å

PDB Description: crystal structure of mavicyanin from cucurbita pepo medullosa (zucchini)
PDB Compounds: (A:) Mavicyanin

SCOPe Domain Sequences for d1ws7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws7a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]}
matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgss

SCOPe Domain Coordinates for d1ws7a_:

Click to download the PDB-style file with coordinates for d1ws7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ws7a_: