SCOPe 2.06: Domain d1wr8b_: 1wr8 B:

Lineage for d1wr8b_ (1wr8 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Phosphoglycolate phosphatase, PGPase [82389] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117502] (1 PDB entry)
   Uniprot O50129 # PH1421

8. Domain d1wr8b_: 1wr8 B: [114837]
   Structural genomics target
   complexed with act

Details for d1wr8b_

PDB Entry: 1wr8, 1.6 Å

PDB Description: Crystal structure of hypothetical protein PH1421 from Pyrococcus horikoshii.

PDB Compounds: (B:) Phosphoglycolate phosphatase

SCOPe Domain Sequences for d1wr8b_:

Sequence; same for both SEQRES and ATOM records:

>d1wr8b_ c.108.1.10 (B:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}
mkikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligts
gpvvaedggaisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimreti
nvetvreiinelnlnlvavdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgen
dldafkvvgykvavaqapkilkenadyvtkkeygeggaeaiyhilekfgyl

Timeline for d1wr8b_:

• d1wr8b_ first appeared in SCOP 1.71
  
• d1wr8b_ appears in SCOPe 2.05
  
• d1wr8b_ appears in SCOPe 2.07
  
• d1wr8b_ appears in the current release, SCOPe 2.08