Lineage for d1wr8b_ (1wr8 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919946Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2919962Protein Phosphoglycolate phosphatase, PGPase [82389] (2 species)
  7. 2919963Species Pyrococcus horikoshii [TaxId:53953] [117502] (1 PDB entry)
    Uniprot O50129 # PH1421
  8. 2919965Domain d1wr8b_: 1wr8 B: [114837]
    Structural genomics target
    complexed with act

Details for d1wr8b_

PDB Entry: 1wr8 (more details), 1.6 Å

PDB Description: Crystal structure of hypothetical protein PH1421 from Pyrococcus horikoshii.
PDB Compounds: (B:) Phosphoglycolate phosphatase

SCOPe Domain Sequences for d1wr8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr8b_ c.108.1.10 (B:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}
mkikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligts
gpvvaedggaisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimreti
nvetvreiinelnlnlvavdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgen
dldafkvvgykvavaqapkilkenadyvtkkeygeggaeaiyhilekfgyl

SCOPe Domain Coordinates for d1wr8b_:

Click to download the PDB-style file with coordinates for d1wr8b_.
(The format of our PDB-style files is described here.)

Timeline for d1wr8b_: