Lineage for d1wr8a_ (1wr8 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1628893Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1628909Protein Phosphoglycolate phosphatase, PGPase [82389] (2 species)
  7. 1628910Species Pyrococcus horikoshii [TaxId:53953] [117502] (1 PDB entry)
    Uniprot O50129 # PH1421
  8. 1628911Domain d1wr8a_: 1wr8 A: [114836]
    Structural genomics target
    complexed with act

Details for d1wr8a_

PDB Entry: 1wr8 (more details), 1.6 Å

PDB Description: Crystal structure of hypothetical protein PH1421 from Pyrococcus horikoshii.
PDB Compounds: (A:) Phosphoglycolate phosphatase

SCOPe Domain Sequences for d1wr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}
kikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligtsg
pvvaedggaisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimretin
vetvreiinelnlnlvavdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgend
ldafkvvgykvavaqapkilkenadyvtkkeygeggaeaiyhilekfgyl

SCOPe Domain Coordinates for d1wr8a_:

Click to download the PDB-style file with coordinates for d1wr8a_.
(The format of our PDB-style files is described here.)

Timeline for d1wr8a_: