Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
Protein Phosphoglycolate phosphatase, PGPase [82389] (2 species) |
Species Pyrococcus horikoshii [TaxId:53953] [117502] (1 PDB entry) Uniprot O50129 # PH1421 |
Domain d1wr8a_: 1wr8 A: [114836] Structural genomics target complexed with act |
PDB Entry: 1wr8 (more details), 1.6 Å
SCOPe Domain Sequences for d1wr8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} kikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligtsg pvvaedggaisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimretin vetvreiinelnlnlvavdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgend ldafkvvgykvavaqapkilkenadyvtkkeygeggaeaiyhilekfgyl
Timeline for d1wr8a_: