SCOP 1.71: Domain d1wr5a_: 1wr5 A:

Lineage for d1wr5a_ (1wr5 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio vulgaris [TaxId:881] [48699] (9 PDB entries)

8. Domain d1wr5a_: 1wr5 A: [114835]
   complexed with eoh, hem; mutant

Details for d1wr5a_

PDB Entry: 1wr5, 1.4 Å

PDB Description: three dimensional structure of the e41k mutant of tetraheme cytochrome c3 from desulfovibrio vulgaris miyazaki f

SCOP Domain Sequences for d1wr5a_:

Sequence; same for both SEQRES and ATOM records:

>d1wr5a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris}
aapkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkkdyqkcatagchdnmdkkd
ksakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

Timeline for d1wr5a_:

• d1wr5a_ is new in SCOP 1.71
  
• d1wr5a_ appears in SCOP 1.73
  
• d1wr5a_ appears in the current release, SCOPe 2.08