Lineage for d1wr5a_ (1wr5 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012600Family a.138.1.1: Cytochrome c3-like [48696] (5 protein domains)
  6. 2012609Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 2012635Species Desulfovibrio vulgaris [TaxId:881] [48699] (18 PDB entries)
    Uniprot P00132
  8. 2012643Domain d1wr5a_: 1wr5 A: [114835]
    complexed with eoh, hem; mutant

Details for d1wr5a_

PDB Entry: 1wr5 (more details), 1.4 Å

PDB Description: Three dimensional Structure of the E41K mutant of Tetraheme Cytochrome c3 from Desulfovibrio vulgaris Miyazaki F
PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1wr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr5a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
aapkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkkdyqkcatagchdnmdkkd
ksakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

SCOPe Domain Coordinates for d1wr5a_:

Click to download the PDB-style file with coordinates for d1wr5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wr5a_: