Lineage for d1wq9a_ (1wq9 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033578Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 3033590Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 3033652Species Russell's viper (Daboia russelli russelli) [TaxId:8707] [118256] (1 PDB entry)
    Uniprot P67861 2-95 # svVEGF (toxin); VR-1
  8. 3033653Domain d1wq9a_: 1wq9 A: [114833]

Details for d1wq9a_

PDB Entry: 1wq9 (more details), 2 Å

PDB Description: crystal structure of vr-1, a vegf-f from a snake venom
PDB Compounds: (A:) vascular endothelial growth factor

SCOPe Domain Sequences for d1wq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wq9a_ g.17.1.1 (A:) Vascular endothelial growth factor, VEGF {Russell's viper (Daboia russelli russelli) [TaxId: 8707]}
evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
khtadiqimrmnprthsskmevmkfmehtacecrpa

SCOPe Domain Coordinates for d1wq9a_:

Click to download the PDB-style file with coordinates for d1wq9a_.
(The format of our PDB-style files is described here.)

Timeline for d1wq9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wq9b_