SCOPe 2.08: Domain d1wpwb_: 1wpw B:

Lineage for d1wpwb_ (1wpw B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [117724] (1 PDB entry)
   Uniprot P50455

8. Domain d1wpwb_: 1wpw B: [114831]
   complexed with mg

Details for d1wpwb_

PDB Entry: 1wpw, 2.8 Å

PDB Description: Crystal Structure of IPMDH from Sulfolobus tokodaii

PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1wpwb_:

Sequence; same for both SEQRES and ATOM records:

>d1wpwb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]}
gftvaliqgdgigpeivskskrilakinelyslpieyieveagdralarygealpkdslk
iidkadiilkgpvgesaadvvvklrqiydmyanirpaksipgidtkygnvdilivrente
dlykgfehivsdgvavgmkiitrfaseriakvglnfalrrrkkvtcvhkanvmritdglf
aeacrsvlkgkveysemyvdaaaanlvrnpqmfdvivtenvygdilsdeasqiagslgia
psanigdkkalfepvhgaafdiagknignptafllsvsmmyermyelsnddryikasral
enaiylvykerkaltpdvggnattddlineiynklg

Timeline for d1wpwb_:

• d1wpwb_ first appeared in SCOP 1.71
  
• d1wpwb_ appears in SCOPe 2.07