Lineage for d1wpwb_ (1wpw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905794Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)
  7. 2905824Species Sulfolobus tokodaii [TaxId:111955] [117724] (1 PDB entry)
    Uniprot P50455
  8. 2905826Domain d1wpwb_: 1wpw B: [114831]
    complexed with mg

Details for d1wpwb_

PDB Entry: 1wpw (more details), 2.8 Å

PDB Description: Crystal Structure of IPMDH from Sulfolobus tokodaii
PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1wpwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpwb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]}
gftvaliqgdgigpeivskskrilakinelyslpieyieveagdralarygealpkdslk
iidkadiilkgpvgesaadvvvklrqiydmyanirpaksipgidtkygnvdilivrente
dlykgfehivsdgvavgmkiitrfaseriakvglnfalrrrkkvtcvhkanvmritdglf
aeacrsvlkgkveysemyvdaaaanlvrnpqmfdvivtenvygdilsdeasqiagslgia
psanigdkkalfepvhgaafdiagknignptafllsvsmmyermyelsnddryikasral
enaiylvykerkaltpdvggnattddlineiynklg

SCOPe Domain Coordinates for d1wpwb_:

Click to download the PDB-style file with coordinates for d1wpwb_.
(The format of our PDB-style files is described here.)

Timeline for d1wpwb_: