Lineage for d1wppb_ (1wpp B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847900Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456
    Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest
  4. 847901Superfamily c.107.1: DHH phosphoesterases [64182] (2 families) (S)
    constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains
  5. 847902Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein)
  6. 847903Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)
  7. 847915Species Streptococcus gordonii [TaxId:1302] [69609] (2 PDB entries)
    Uniprot P95765
  8. 847919Domain d1wppb_: 1wpp B: [114829]
    complexed with cl, so4, zn

Details for d1wppb_

PDB Entry: 1wpp (more details), 2.05 Å

PDB Description: structure of streptococcus gordonii inorganic pyrophosphatase
PDB Compounds: (B:) probable manganese-dependent inorganic pyrophosphatase

SCOP Domain Sequences for d1wppb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wppb_ c.107.1.1 (B:) Manganese-dependent inorganic pyrophosphatase (family II) {Streptococcus gordonii [TaxId: 1302]}
skilvfghqnpdsdaigssyafaylareaygldteavalgepneetafvldyfgvaaprv
itsakaegaeqviltdhnefqqsvadiaevevygvvdhhrvanfetasplymrlepvgsa
ssivyrmfkehgvavpkeiaglmlsglisdtlllksptthptdkviapelaelagvnlee
yglamlkagtnlasksaeelididaktfelngnnvrvaqvntvdiaevlerqaeieaaie
kaiadngysdfvlmitdiinsnseilaigsnmdkveaafnfvlennhaflagavsrkkqv
vpqltesfna

SCOP Domain Coordinates for d1wppb_:

Click to download the PDB-style file with coordinates for d1wppb_.
(The format of our PDB-style files is described here.)

Timeline for d1wppb_: